Overview

  • Product name

    Anti-Glycogen synthase 2 antibody - C-terminal
    See all Glycogen synthase 2 primary antibodies
  • Description

    Rabbit polyclonal to Glycogen synthase 2 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Glycogen synthase 2 aa 642-703 (C terminal).
    Sequence:

    VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVP HGKKKLHGEYKN


    Database link: P54840

  • Positive control

    • WB: Human liver tissue lysate. IHC-P: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 81 kDa.

Target

  • Function

    Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
  • Pathway

    Glycan biosynthesis; glycogen biosynthesis.
  • Involvement in disease

    Defects in GYS2 are the cause of glycogen storage disease type 0 (GSD0) [MIM:240600]; A metabolic disorder characterized by fasting hypoglycemia presenting in infancy or early childhood, high blood ketones and low alanine and lactate concentrations. Although feeding relieves symptoms, it often results in postprandial hyperglycemia and hyperlactatemia.
  • Sequence similarities

    Belongs to the glycosyltransferase 3 family.
  • Post-translational
    modifications

    Primed phosphorylation at Ser-657 (site 5) by CSNK2A1 and CSNK2A2 is required for inhibitory phosphorylation at Ser-641 (site 3a), Ser-645 (site 3b), Ser-649 (site 3c) and Ser-653 (site 4) by GSK3A an GSK3B. Dephosphorylation at Ser-641 and Ser-645 by PP1 activates the enzyme.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.4.1.11 antibody
    • Glycogen [starch] synthase antibody
    • Glycogen starch synthase liver antibody
    • Glycogen synthase 2 liver antibody
    • Gys2 antibody
    • GYS2_HUMAN antibody
    • liver antibody
    see all

Images

  • All lanes : Anti-Glycogen synthase 2 antibody - C-terminal (ab224552) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Developed using the ECL technique.

    Predicted band size: 81 kDa

  • Paraffin-embedded human liver tissue stained for Glycogen synthase 2 using ab224552 at 1/200 dilution in immunohistochemical analysis.

References

ab224552 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up