Overview

  • Product name

    Anti-Glycogenin 2 antibody
    See all Glycogenin 2 primary antibodies
  • Description

    Rabbit polyclonal to Glycogenin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Glycogenin 2 aa 378-470.
    Sequence:

    MIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETF EPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPE


    Database link: O15488

  • Positive control

    • Human liver tissue; RT-4 and U-251 MG cell lysates; SK-MEL-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 55 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human liver tissue, labeling Glycogenin 2 with ab204784 at 1/1000 dilution.

  • Immunofluorescent analysis of SK-MEL-30 cells (PFA-fixed/Triton X-100 permeabilized) labeling Glycogenin 2 with ab204784 at 4 µg/ml (green).

  • All lanes : Anti-Glycogenin 2 antibody (ab204784) at 1/500 dilution

    Lane 1 : RT-4 cell lysates
    Lane 2 : U-251 MG cell lysates

    Developed using the ECL technique.

    Predicted band size: 55 kDa

References

ab204784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up