Overview

  • Product name
    Anti-Glycophorin C antibody
    See all Glycophorin C primary antibodies
  • Description
    Rabbit polyclonal to Glycophorin C
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Glycophorin C aa 1-128.
    Sequence:

    MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRME TSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTE FAESADAALQGDPALQDAGDSSRKEYFI


    Database link: P04921

  • Positive control
    • TF-1 and K562 cell lysate and Red blood cells

Properties

Applications

Our Abpromise guarantee covers the use of ab175257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 14 kDa.

Target

  • Function
    This protein is a minor sialoglycoprotein in human erythrocyte membranes. The blood group Gerbich antigens and receptors for Plasmodium falciparum merozoites are most likely located within the extracellular domain. Glycophorin-C plays an important role in regulating the stability of red cells.
  • Tissue specificity
    Glycophorin-C is expressed in erythrocytes. Glycophorin-D is ubiquitous.
  • Sequence similarities
    Belongs to the glycophorin-C family.
  • Cellular localization
    Cell membrane. Linked to the membrane via band 4.1.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD236 antibody
    • CD236R antibody
    • GE antibody
    • GLPC antibody
    • GLPC_HUMAN antibody
    • Glycoconnectin antibody
    • Glycophorin C (Gerbich blood group) antibody
    • Glycophorin D antibody
    • Glycophorin-C antibody
    • Glycophorin-D antibody
    • Glycoprotein beta antibody
    • GPC antibody
    • GPD antibody
    • Gypc antibody
    • GYPD antibody
    • MGC117309 antibody
    • MGC126191 antibody
    • MGC126192 antibody
    • PAS 2 antibody
    • PAS 2' antibody
    • PAS-2'' antibody
    • Sialoglycoprotein D antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophageal cancer tissue labelling GYPC with ab175257 at 1/200. Magnification: 200x.
  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175257. Blue DAPI for nuclear staining.
  • All lanes : Anti-Glycophorin C antibody (ab175257) at 1/500 dilution

    Lane 1 : TF-1 cell line lysate
    Lane 2 : K562 cell line lysate
    Lane 3 : Red blood cells

    Predicted band size: 14 kDa

References

ab175257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up