Anti-Glycophorin C/GPC antibody (ab175257)
Key features and details
- Rabbit polyclonal to Glycophorin C/GPC
- Suitable for: ICC/IF, IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Glycophorin C/GPC antibody
See all Glycophorin C/GPC primary antibodies -
Description
Rabbit polyclonal to Glycophorin C/GPC -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Glycophorin C/GPC aa 1-128.
Sequence:MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRME TSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTE FAESADAALQGDPALQDAGDSSRKEYFI
Database link: P04921 -
Positive control
- TF-1 and K562 cell lysate and Red blood cells
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab175257 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use at an assay dependent concentration.
|
|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
WB |
1/500 - 1/2000. Predicted molecular weight: 14 kDa.
|
Notes |
---|
ICC/IF
Use at an assay dependent concentration. |
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
WB
1/500 - 1/2000. Predicted molecular weight: 14 kDa. |
Target
-
Function
This protein is a minor sialoglycoprotein in human erythrocyte membranes. The blood group Gerbich antigens and receptors for Plasmodium falciparum merozoites are most likely located within the extracellular domain. Glycophorin-C plays an important role in regulating the stability of red cells. -
Tissue specificity
Glycophorin-C is expressed in erythrocytes. Glycophorin-D is ubiquitous. -
Sequence similarities
Belongs to the glycophorin-C family. -
Cellular localization
Cell membrane. Linked to the membrane via band 4.1. - Information by UniProt
-
Database links
- Entrez Gene: 2995 Human
- Omim: 110750 Human
- SwissProt: P04921 Human
- Unigene: 59138 Human
-
Alternative names
- CD236 antibody
- CD236R antibody
- GE antibody
see all
Images
-
All lanes : Anti-Glycophorin C/GPC antibody (ab175257) at 1/500 dilution
Lane 1 : TF-1 cell line lysate
Lane 2 : K562 cell line lysate
Lane 3 : Red blood cells
Predicted band size: 14 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophageal cancer tissue labelling GYPC with ab175257 at 1/200. Magnification: 200x.
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175257. Blue DAPI for nuclear staining.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab175257 has been referenced in 1 publication.
- Adderley JD et al. Analysis of erythrocyte signalling pathways during Plasmodium falciparum infection identifies targets for host-directed antimalarial intervention. Nat Commun 11:4015 (2020). PubMed: 32782246