Overview

  • Product name

    Anti-Glycophorin C/GPC antibody
    See all Glycophorin C/GPC primary antibodies
  • Description

    Rabbit polyclonal to Glycophorin C/GPC
  • Host species

    Rabbit
  • Specificity

    This antibody detects endogenous level of total Glycophorin C/GPC protein.

  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Glycophorin C/GPC aa 1-128.
    Sequence:

    MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRME TSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTE FAESADAALQGDPALQDAGDSSRKEYFI


    Database link: P04921

  • Positive control

    • Human esophageal cancer tissue and MCF-7 cells.
  • General notes

     This product was previously labelled as Glycophorin C

     

Properties

Applications

Our Abpromise guarantee covers the use of ab196568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/100.
ICC/IF 1/50 - 1/200.

Target

  • Function

    This protein is a minor sialoglycoprotein in human erythrocyte membranes. The blood group Gerbich antigens and receptors for Plasmodium falciparum merozoites are most likely located within the extracellular domain. Glycophorin-C plays an important role in regulating the stability of red cells.
  • Tissue specificity

    Glycophorin-C is expressed in erythrocytes. Glycophorin-D is ubiquitous.
  • Sequence similarities

    Belongs to the glycophorin-C family.
  • Cellular localization

    Cell membrane. Linked to the membrane via band 4.1.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD236 antibody
    • CD236R antibody
    • GE antibody
    • GLPC antibody
    • GLPC_HUMAN antibody
    • Glycoconnectin antibody
    • Glycophorin C (Gerbich blood group) antibody
    • Glycophorin D antibody
    • Glycophorin-C antibody
    • Glycophorin-D antibody
    • Glycoprotein beta antibody
    • GPC antibody
    • GPD antibody
    • Gypc antibody
    • GYPD antibody
    • MGC117309 antibody
    • MGC126191 antibody
    • MGC126192 antibody
    • PAS 2 antibody
    • PAS 2' antibody
    • PAS-2'' antibody
    • Sialoglycoprotein D antibody
    see all

Images

  • Immunofluorescent analysis of MCF-7 cells labeling Glycophorin C/GPC with ab196568 at 1/50 dilution. Blue: DAPI for nuclear staining.

  • Immunohistochemical analysis of paraffin-embedded human esophageal cancer tissue labeling Glycophorin C/GPC with ab196568 at 1/200 dilution. 

References

ab196568 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up