Overview

  • Product name

    Anti-Glypican 1/ GPC1 antibody
    See all Glypican 1/ GPC1 primary antibodies
  • Description

    Rabbit polyclonal to Glypican 1/ GPC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human Glypican 1/ GPC1 aa 114-277. Expressed in E.coli.
    Sequence:

    LLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETL AEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRA TRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVP GARPCPDYCRNVLK


    Database link: P35052

  • Positive control

    • WB: Recombinant human Glypican 1/ GPC1 protein; Human lung and pig kidney tissue lysate; HepG2 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 62 kDa.

Target

Images

  • Anti-Glypican 1/ GPC1 antibody (ab233084) at 2 µg/ml + Recombinant human Glypican 1 / GPC1

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 62 kDa

  • All lanes : Anti-Glypican 1/ GPC1 antibody (ab233084) at 2 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 3 : Pig kidney tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 62 kDa

References

ab233084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up