Overview

  • Product name

  • Description

    Rabbit polyclonal to Glypican 5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Glypican 5 aa 377-471.
    Sequence:

    EETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWNGEDIVK SYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQG


    Database link: P78333

  • Positive control

    • U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Cell surface proteoglycan that bears heparan sulfate.
  • Tissue specificity

    In adult, primarily expressed in the brain. Also detected in fetal brain, lung and liver.
  • Sequence similarities

    Belongs to the glypican family.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA93M14.1 antibody
    • glypican 5 antibody
    • Glypican 5 precursor antibody
    • glypican proteoglycan 5 antibody
    • Glypican-5 antibody
    • GPC5 antibody
    • GPC5_HUMAN antibody
    • Secreted glypican-5 antibody
    see all

Images

  • Immunofluorescent analysis of U-2 OS cells (PFA-fixed/Triton X-100 permeabilized) labeling Glypican 5 with ab220318 at 4μg/ml (green).

References

ab220318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up