Overview

  • Product name

  • Description

    Rabbit polyclonal to GM-CSF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GM-CSF aa 26-83.
    Sequence:

    STQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTR LELYKQGL


    Database link: P04141

  • Positive control

    • A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
  • Sequence similarities

    Belongs to the GM-CSF family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Colony stimulating factor 2 (granulocyte-macrophage) antibody
    • Colony Stimulating Factor 2 antibody
    • Colony stimulating factor antibody
    • Colony-stimulating factor antibody
    • CSF 2 antibody
    • CSF antibody
    • CSF2 antibody
    • CSF2_HUMAN antibody
    • GM-CSF antibody
    • GMCSF antibody
    • Granulocyte Macrophage Colony Stimulating Factor antibody
    • Granulocyte-macrophage colony-stimulating factor antibody
    • MGC131935 antibody
    • MGC138897 antibody
    • MGI1GM antibody
    • Molgramostin antibody
    • Pluripoietin-a antibody
    • Sargramostim antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A431 cells labeling GM-CSF with ab220888 at 4 μg/ml (green).

References

ab220888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up