Overview

  • Product name

  • Description

    Rabbit polyclonal to GM130
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human GM130 aa 20-300.
    Sequence:

    SKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPED TPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETK TFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVA LDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVH IQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELE RALSAVSTQQKKADRYNKELTKERDALRLEL


    Database link: Q08379

  • Positive control

    • Raji, HeLa and OVCAR3 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab187514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 113 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Golgi auto-antigen; probably involved in maintaining cis-Golgi structure.
  • Sequence similarities

    Belongs to the GOLGA2 family.
  • Domain

    Extended rod-like protein with coiled-coil domains.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 130 kDa cis Golgi matrix protein antibody
    • 130 kDa cis-Golgi matrix protein antibody
    • Cis golgi matrix protein GM130 antibody
    • GM130 antibody
    • Gm130 autoantigen antibody
    • GOGA2_HUMAN antibody
    • GOLGA 2 antibody
    • Golga2 antibody
    • Golgi autoantigen antibody
    • Golgi autoantigen golgin subfamily a 2 antibody
    • Golgi matrix protein GM130 antibody
    • Golgin 95 antibody
    • golgin A2 antibody
    • Golgin subfamily a 2 antibody
    • Golgin subfamily A member 2 antibody
    • Golgin-95 antibody
    • MGC20672 antibody
    • SY11 protein antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human thyroid cancer tissue labelling GM130 with ab187514 at 1/200. Magnification: 400x.
  • All lanes : Anti-GM130 antibody (ab187514) at 1/500 dilution

    Lane 1 : Raji cell extract
    Lane 2 : HeLa cell extract
    Lane 3 : OVCAR3 cell extract

    Predicted band size: 113 kDa

References

ab187514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up