Overview

  • Product name

    Anti-Gm13152 antibody - N-terminal
  • Description

    Rabbit polyclonal to Gm13152 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Horse, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide derived from a region within N terminal amino acids 1-50 (

    MSVFLVNTPQGLLTFKDVAVEFSLEEWERLSFAQRSLCIDVMLENYNNLL

    ) of Mouse Gm13152 (NM_001039209.2).

  • Positive control

    • Mouse lung lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab136626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa.

Target

Images

  • Anti-Gm13152 antibody - N-terminal (ab136626) at 1 µg/ml + Mouse lung cell lysate at 10 µg

    Predicted band size: 43 kDa

References

ab136626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cultured Cells (mESC)
Permeabilization
Yes - triton 0.2%, NDS 10% in PBS
Specification
mESC
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Oct 18 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up