Overview

  • Product name

  • Description

    Rabbit polyclonal to GMAP-210
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human GMAP-210 aa 1760-1855.
    Sequence:

    MLDDVQKKLMSLANSSEGKVDKVLMRNLFIGHFHTPKNQRHEVLRLMGSI LGVRREEMEQLFHDDQGSVTRWMTGWLGGGSKSVPNTPLRPNQQSV


    Database link: Q15643

  • Positive control

    • ICC/IF: HaCaT cells.
  • General notes

     This product was previously labelled as TRIP230

     

Properties

Applications

Our Abpromise guarantee covers the use of ab221879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    TRIP230 was identified through its ability to interact functionally with thyroid hormone receptor-beta. It has also been found in association with the Golgi apparatus and microtubules. TRIP230 binds the ligand binding domain of the thyroid receptor (THRB) in the presence of triiodothyronine and enhances THRB-modulated transcription. This protein is probably involved in maintaining cis-Golgi structure.
  • Cellular localization

    Cell Membrane and Golgi Apparatus
  • Database links

  • Alternative names

    • CEV 14 antibody
    • CEV14 antibody
    • Clonal evolution related gene on chromosome 14 antibody
    • GMAP 210 antibody
    • GMAP210 antibody
    • Golgi associated microtubule binding protein 210 antibody
    • Thyroid hormone receptor interactor 11 antibody
    • Thyroid receptor interacting protein 11 antibody
    • TRIP 11 antibody
    • TRIP 230 antibody
    • TRIP11 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized HaCaT (human keratinocyte cell line) cells stained for GMAP-210 (green) using ab221879 at 4 ug/ml in ICC/IF.

References

ab221879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up