Overview

  • Product name

  • Description

    Rabbit polyclonal to GMDS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Chinese hamster
  • Immunogen

    Recombinant fragment corresponding to Mouse GMDS aa 243-346.
    Sequence:

    LDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHI GKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQK LNWK


    Database link: O60547

  • Positive control

    • IHC-P: Human breast cancer tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Conversion of GDP-D-mannose to GDP-4-keto-6-D-deoxymannose.
  • Pathway

    Nucleotide-sugar biosynthesis; GDP-L-fucose biosynthesis via de novo pathway; GDP-L-fucose from GDP-alpha-D-mannose: step 1/2.
  • Sequence similarities

    Belongs to the GDP-mannose 4,6-dehydratase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • GDP D mannose dehydratase antibody
    • GDP mannose 4 6 dehydratase antibody
    • GDP-D-mannose dehydratase antibody
    • GDP-mannose 4,6 dehydratase antibody
    • GMD antibody
    • Gmds antibody
    • GMDS_HUMAN antibody
    • OTTHUMP00000017756 antibody
    • OTTHUMP00000232770 antibody
    • SDR3E1 antibody
    • Short chain dehydrogenase/reductase family 3E member 1 antibody
    see all

Images

  • Paraffin-embedded human breast cancer tissue stained for GMDS using ab238613 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GMDS (Green) using ab238613 at 1/133 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. The nuclear counterstain was DAPI (Blue).

References

ab238613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up