Overview

  • Product name

  • Description

    Rabbit polyclonal to GMFB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human GMFB aa 2-109.
    Sequence:

    SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEG ISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQ MMYAGSKN


    Database link: P60983

  • Positive control

    • ICC/IF: U-251 MG cells. WB: NIH/3T3, A431 and NBT-II cell lysates; Human and mouse cerebral cortex tissue lysates. IHC-P: Mouse somatosensory cortex, olfactory bulb, lateral septum, red nucleus and cerebellum tissues; Human cerebral cortex and hippocampus tissues.
  • General notes

     This product was previously labelled as GMF beta

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 17 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

Images

  • Paraffin-embedded mouse cerebellum tissue stained for GMFB using ab224322 at 1/200 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • PFA-fixed/Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for GMFB (green) using ab224322 at 4 µg/ml in ICC/IF.

  • Anti-GMFB antibody (ab224322) at 1/100 dilution + A431 (human epidermoid carcinoma cell line) cell lysate

    Developed using the ECL technique.

    Predicted band size: 17 kDa

  • Paraffin-embedded human hippocampus tissue stained for GMFB using ab224322 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse red nucleus tissue stained for GMFB using ab224322 at 1/200 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded mouse lateral septum tissue stained for GMFB using ab224322 at 1/200 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded mouse olfactory bulb tissue stained for GMFB using ab224322 at 1/200 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Paraffin-embedded human cerebral cortex tissue stained for GMFB using ab224322 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse somatosensory cortex tissue stained for GMFB using ab224322 at 1/200 dilution in immunohistochemical analysis using a fluorescent secondary antibody.

  • Anti-GMFB antibody (ab224322) at 1/100 dilution + Human cerebral cortex tissue lysate

    Developed using the ECL technique.

    Predicted band size: 17 kDa

  • Anti-GMFB antibody (ab224322) at 1/100 dilution + Mouse cerebral cortex tissue lysate

    Developed using the ECL technique.

    Predicted band size: 17 kDa

  • All lanes : Anti-GMFB antibody (ab224322) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 17 kDa

References

This product has been referenced in:

  • Thangavel R  et al. Co-Expression of Glia Maturation Factor and Apolipoprotein E4 in Alzheimer's Disease Brain. J Alzheimers Dis 61:553-560 (2018). IHC-P . Read more (PubMed: 29172001) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up