Overview

  • Product name

    Anti-GMPPA antibody
  • Description

    Rabbit polyclonal to GMPPA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Pig
  • Immunogen

    Recombinant fragment corresponding to Human GMPPA aa 169-246.
    Sequence:

    EKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDSPGLWPGAG TIRLEQDVFSALAGQGQIYVHLTDGIWS


    Database link: Q96IJ6

  • Positive control

    • Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human pancreas tissue labeling GMPPA with ab203889 at 1/50 dilution.

References

ab203889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up