Anti-GNA13 antibody (ab246892)

Submit a review Submit a question
Immunocytochemistry/ Immunofluorescence - Anti-GNA13 antibody (ab246892)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNA13 antibody (ab246892)

Key features and details

  • Rabbit polyclonal to GNA13
  • Suitable for: IHC-P, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-GNA13 antibody
    See all GNA13 primary antibodies

  • Description

    Rabbit polyclonal to GNA13

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human GNA13 aa 72-173.
    Sequence:

    HGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGDK MMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLG ES


    Database link: Q14344
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: human stomach tissue. ICC/IF: SH-SY5Y cells.

  • General notes

     This product was previously labelled as G protein alpha 13

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol (glycerin, glycerine), PBS
  • Concentration information loading...

  • Purity

    Immunogen affinity purified

  • Clonality

    Polyclonal

  • Isotype

    IgG

  • Research areas

Applications

Our Abpromise guarantee covers the use of ab246892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 0.25 - 2 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

  • Sequence similarities

    Belongs to the G-alpha family. G(12) subfamily.

  • Post-translational
    modifications

    Palmitoylation is critical for proper membrane localization and signaling.
    Phosphorylation on Thr-203 by PKA destabilizes the heterotrimer of alpha, beta and gamma, and inhibits Rho activation.

  • Cellular localization

    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

  • Database links

    • Alternative names

      • G alpha 13 antibody
      • G alpha-13 antibody
      • G-protein subunit alpha-13 antibody
      • GNA13 antibody
      • GNA13_HUMAN antibody
      • Guanine nucleotide binding protein (G protein) alpha 13 antibody
      • Guanine nucleotide binding protein alpha 13 subunit antibody
      • Guanine nucleotide-binding protein subunit alpha-13 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-GNA13 antibody (ab246892)
      Immunocytochemistry/ Immunofluorescence - Anti-GNA13 antibody (ab246892)

      PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for GNA13 (green) using ab246892 at 4 µg/ml in ICC/IF.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNA13 antibody (ab246892)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNA13 antibody (ab246892)

      Paraffin-embedded human stomach tissue stained for GNA13 using ab246892 at 1/50 dilution in immunohistochemical analysis.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab246892? Please let us know so that we can cite the reference in this datasheet.

    ab246892 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab246892.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com