Anti-GNA14 antibody (ab236095)
Key features and details
- Rabbit polyclonal to GNA14
- Suitable for: IHC-P, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-GNA14 antibody -
Description
Rabbit polyclonal to GNA14 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Cow, Xenopus laevis
-
Immunogen
Recombinant fragment corresponding to Human GNA14 aa 8-303.
Sequence:SAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRI IHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQ IIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYL TDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRS ERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITY PWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARD
Database link: O95837 -
Positive control
- WB: Mouse lung tissue lysate. IHC-P: Human prostate cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab236095 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. | |
| WB | 1/1000 - 1/5000. |
Target
-
Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. -
Sequence similarities
Belongs to the G-alpha family. G(q) subfamily. - Information by UniProt
-
Database links
- Entrez Gene: 281789 Cow
- Entrez Gene: 9630 Human
- Entrez Gene: 14675 Mouse
- Entrez Gene: 399096 Xenopus laevis
- Omim: 604397 Human
- SwissProt: P38408 Cow
- SwissProt: O95837 Human
- SwissProt: P30677 Mouse
see all -
Alternative names
- AU023208 antibody
- g alpha 14 antibody
- G alpha-14 antibody
see all
Images
-
Western blot - Anti-GNA14 antibody (ab236095)Anti-GNA14 antibody (ab236095) at 1/1000 dilution + Mouse lung tissue lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNA14 antibody (ab236095)Paraffin-embedded human prostate cancer tissue stained for GNA14 using ab236095 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236095 has not yet been referenced specifically in any publications.
