Overview

  • Product name

    Anti-GNA14 antibody
  • Description

    Rabbit polyclonal to GNA14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human GNA14 aa 8-303.
    Sequence:

    SAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRI IHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQ IIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYL TDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRS ERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITY PWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARD


    Database link: O95837

  • Positive control

    • WB: Mouse lung tissue lysate. IHC-P: Human prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236095 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000.

Target

Images

  • Anti-GNA14 antibody (ab236095) at 1/1000 dilution + Mouse lung tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human prostate cancer tissue stained for GNA14 using ab236095 at 1/100 dilution in immunohistochemical analysis.

References

ab236095 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236095.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up