Overview

  • Product name

  • Description

    Mouse polyclonal to GNA15
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit
  • Immunogen

    Full length protein corresponding to Human GNA15 aa 1-374.
    Sequence:

    MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGP GESGKSTFIKQMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERL QIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYER RREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQ KTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENR MKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ NIRKVFKDVRDSVLARYLDEINLL

  • Positive control

    • GNA15 transfected 293T cell lysate.
  • General notes

     This product was previously labelled as G protein alpha 16

     

Properties

Applications

Our Abpromise guarantee covers the use of ab169307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa.

Target

  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Tissue specificity

    Specifically expressed in hematopoietic cells.
  • Sequence similarities

    Belongs to the G-alpha family. G(q) subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • G alpha 15 antibody
    • G alpha 16 antibody
    • G alpha-15 antibody
    • G alpha-16 antibody
    • G-protein subunit alpha-15 antibody
    • G-protein subunit alpha-16 antibody
    • GNA 15 antibody
    • GNA 16 antibody
    • GNA15 antibody
    • GNA15_HUMAN antibody
    • GNA16 antibody
    • Gq class antibody
    • Guanine nucleotide binding protein alpha 15 antibody
    • Guanine nucleotide binding protein alpha 15 subunit antibody
    • Guanine nucleotide-binding protein subunit alpha-15 antibody
    • Guanine nucleotide-binding protein subunit alpha-16 antibody
    see all

Images

  • All lanes : Anti-GNA15 antibody (ab169307) at 1 µg

    Lane 1 : GNA15 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 44 kDa

References

ab169307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up