Overview

  • Product name

  • Description

    Rabbit polyclonal to GNA15
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human GNA15 aa 1-374.
    Sequence:

    MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGP GESGKSTFIKQMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERL QIPFSRPESKHHASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRAYYER RREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQ KTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENR MKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQ NIRKVFKDVRDSVLARYLDEINLL


    Database link: P30679

  • Positive control

    • IHC-P: Human small intestine and skeletal muscle tissue.
  • General notes

     This product was previously labelled as G protein alpha 16

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Tissue specificity

    Specifically expressed in hematopoietic cells.
  • Sequence similarities

    Belongs to the G-alpha family. G(q) subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • G alpha 15 antibody
    • G alpha 16 antibody
    • G alpha-15 antibody
    • G alpha-16 antibody
    • G-protein subunit alpha-15 antibody
    • G-protein subunit alpha-16 antibody
    • GNA 15 antibody
    • GNA 16 antibody
    • GNA15 antibody
    • GNA15_HUMAN antibody
    • GNA16 antibody
    • Gq class antibody
    • Guanine nucleotide binding protein alpha 15 antibody
    • Guanine nucleotide binding protein alpha 15 subunit antibody
    • Guanine nucleotide-binding protein subunit alpha-15 antibody
    • Guanine nucleotide-binding protein subunit alpha-16 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for GNA15 with ab230021 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for GNA15 with ab230021 at 1/100 dilution in immunohistochemical analysis.

References

ab230021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up