Overview

  • Product name

  • Description

    Rabbit Polyclonal to GNAS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Hamster, Cow, Dog, Pig, Chinese hamster
  • Immunogen

    Recombinant full length protein corresponding to Human G protein alpha S aa 1-394.
    Sequence:

    MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGE SGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLK EAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHA KALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRC RVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVAS SSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRIST ASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL


    Database link: P63092-1

  • Positive control

    • WB: Rat and mouse brain tissue lysates. IHC-P: Human brain tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 46 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The Gs protein is involved in hormonal regulation of adenylate cyclase: it activates the cyclase in response to beta-adrenergic stimuli. Alternative splicing of downstream exons of the GNAS gene is observed, which results in different forms of the stimulatory G protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • Adenylate cyclase stimulating G alpha protein antibody
    • AHO antibody
    • Alternative gene product encoded by XL exon antibody
    • C20orf45 antibody
    • dJ309F20.1.1 antibody
    • dJ806M20.3.3 antibody
    • Extra large alphas protein antibody
    • GNAS antibody
    • GNAS complex locus antibody
    • GNAS1 antibody
    • GPSA antibody
    • Gs alpha subunit antibody
    • GSA antibody
    • GSP antibody
    • Guanine nucleotide binding protein (G protein) alpha stimulating activity polypeptide 1 antibody
    • Guanine nucleotide binding protein alpha stimulating activity polypeptide 1 antibody
    • Guanine nucleotide binding protein G(s) subunit alpha isoforms short antibody
    • Guanine nucleotide binding protein G(s) subunit alpha isoforms XLas antibody
    • Guanine nucleotide regulatory protein antibody
    • MGC33735 antibody
    • NESP antibody
    • NESP55 antibody
    • Neuroendocrine secretory protein antibody
    • PHP1A antibody
    • PHP1B antibody
    • PHP1C antibody
    • POH antibody
    • Protein ALEX antibody
    • Protein GNAS antibody
    • Protein NESP55 antibody
    • SCG6 antibody
    • Secretogranin VI antibody
    • XLalphas antibody
    • XLas antibody
    see all

Images

  • All lanes : Anti-GNAS antibody (ab235956) at 1/500 dilution

    Lane 1 : Rat brain tissue lysate
    Lane 2 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 46 kDa

  • MCF7 (human breast adenocarcinoma cell line) cells stained for G protein alpha S (Green) using ab235956 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human brain tissue stained for G protein alpha S with ab235956 at 1/100 dilution in immunohistochemical analysis.

References

ab235956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up