Overview

  • Product name

    Anti-GNB1L/GY2 antibody
  • Description

    Rabbit polyclonal to GNB1L/GY2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human GNB1L/GY2 aa 1-327.
    Sequence:

    MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVH IWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEG RSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTS VCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKV CSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHE LTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQC VAFTADGLLAAGSKDQRISLWSLYPRA


    Database link: Q9BYB4-1

  • Positive control

    • WB: Mouse brain lysate; Jurkat cell lysate. IHC-P: Human thyroid and kidney tissues.
  • General notes

     This product was previously labelled as GNB1L

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa).

Target

  • Tissue specificity

    Ubiquitous. Highly expressed in heart, liver, skeletal muscle, kidney, spleen, thymus and pancreas. Detected at low levels in lung, placenta and brain.
  • Sequence similarities

    Contains 6 WD repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • DGCRK3 antibody
    • ESTM55 antibody
    • fb98e06 antibody
    • fj09d12 antibody
    • FKSG1 antibody
    • G protein subunit beta-like protein 1 antibody
    • G-protein beta subunit-like protein antibody
    • GNB1L antibody
    • GNB1L_HUMAN antibody
    • guanine nucleotide binding protein (G protein), beta polypeptide 1-like antibody
    • guanine nucleotide binding protein beta-subunit-like polypeptide antibody
    • Guanine nucleotide-binding protein subunit beta-like protein 1 antibody
    • GY2 antibody
    • KIAA1645 antibody
    • WD repeat-containing protein 14 antibody
    • WD40 repeat-containing protein deleted in VCFS antibody
    • WDR14 antibody
    • WDVCF antibody
    • wu:fb98e06 antibody
    • wu:fj09d12 antibody
    • zgc:55774 antibody
    see all

Images

  • All lanes : Anti-GNB1L/GY2 antibody (ab234648) at 1/1000 dilution

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 36 kDa

  • Paraffin-embedded human thyroid tissue stained for GNB1L/GY2 using ab234648 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for GNB1L/GY2 using ab234648 at 1/100 dilution in immunohistochemical analysis.

References

ab234648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up