Overview

  • Product name

  • Description

    Rabbit polyclonal to GNB4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human GNB4 aa 215-264 (internal sequence).
    Sequence:

    DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY


    Database link: NP_067642

  • Positive control

    • HCT15 cell lysate
  • General notes

     This product was previously labelled as G protein beta 4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab106599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 38 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Tissue specificity

    Strongly expressed in lung and placenta, whereas it is weakly expressed in brain and heart.
  • Sequence similarities

    Belongs to the WD repeat G protein beta family.
    Contains 7 WD repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • G protein beta 4 subunit antibody
    • GBB4_HUMAN antibody
    • GNB 4 antibody
    • Gnb4 antibody
    • Guanine nucleotide binding protein (G protein) beta polypeptide 4 antibody
    • Guanine nucleotide binding protein beta 4 subunit antibody
    • Guanine nucleotide binding protein beta polypeptide 4 antibody
    • Guanine nucleotide binding protein beta subunit 4 antibody
    • Guanine nucleotide binding protein subunit beta 4 antibody
    • Guanine nucleotide-binding protein subunit beta-4 antibody
    • Transducin beta chain 4 antibody
    see all

Images

  • Western blot analysis of HEK293 cell lysate labeling GNB4 with ab106599.

  • Anti-GNB4 antibody (ab106599) at 1 µg/ml + HCT15 cell lysate at 10 µg

    Predicted band size: 38 kDa



    Gel concentration: 12%

References

ab106599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up