Anti-GNB4 antibody (ab223113)
Key features and details
- Rabbit polyclonal to GNB4
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-GNB4 antibody -
Description
Rabbit polyclonal to GNB4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human GNB4 aa 105-185.
Sequence:YAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDD SQIVTSSGDTTCALWDIETAQQTTTFTGHSG
Database link: Q9HAV0 -
Positive control
- WB: Rat liver tissue lysate; Mouse liver and kidney tissue lysates. IHC-P: Human pancreatic and colon cancer tissues. ICC/IF: HeLa cells.
-
General notes
This product was previously labelled as G protein beta 4
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab223113 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Detects a band of approximately 38 kDa (predicted molecular weight: 38 kDa). | |
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. -
Tissue specificity
Strongly expressed in lung and placenta, whereas it is weakly expressed in brain and heart. -
Sequence similarities
Belongs to the WD repeat G protein beta family.
Contains 7 WD repeats. - Information by UniProt
-
Database links
- Entrez Gene: 59345 Human
- Entrez Gene: 14696 Mouse
- Entrez Gene: 294962 Rat
- Omim: 610863 Human
- SwissProt: Q9HAV0 Human
- SwissProt: P29387 Mouse
- SwissProt: Q3THF3 Mouse
- SwissProt: Q3TY18 Mouse
see all -
Alternative names
- G protein beta 4 subunit antibody
- GBB4_HUMAN antibody
- GNB 4 antibody
see all
Images
-
All lanes : Anti-GNB4 antibody (ab223113) at 1/500 dilution
Lane 1 : Rat liver tissue lysate
Lane 2 : Mouse liver tissue lysate
Lane 3 : Mouse kidney tissue lysate
Secondary
All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution
Predicted band size: 38 kDa
Observed band size: 38 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNB4 antibody (ab223113)
Paraffin-embedded human pancreatic cancer tissue stained for GNB4 using ab223113 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNB4 antibody (ab223113)
Paraffin-embedded human colon cancer tissue stained for GNB4 using ab223113 at 1/100 dilution in immunohistochemical analysis.
-
HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GNB4 (green) using ab223113 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).
Protocols
References (0)
ab223113 has not yet been referenced specifically in any publications.