Anti-GNB4 antibody (ab223113)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GNB4 antibody
See all GNB4 primary antibodies -
Description
Rabbit polyclonal to GNB4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human GNB4 aa 105-185.
Sequence:YAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDD SQIVTSSGDTTCALWDIETAQQTTTFTGHSG
Database link: Q9HAV0 -
Positive control
- WB: Rat liver tissue lysate; Mouse liver and kidney tissue lysates. IHC-P: Human pancreatic and colon cancer tissues. ICC/IF: HeLa cells.
-
General notes
This product was previously labelled as G protein beta 4
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab223113 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/5000. Detects a band of approximately 38 kDa (predicted molecular weight: 38 kDa). | |
| IHC-P | 1/20 - 1/200. | |
| ICC/IF | 1/50 - 1/200. |
Target
-
Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. -
Tissue specificity
Strongly expressed in lung and placenta, whereas it is weakly expressed in brain and heart. -
Sequence similarities
Belongs to the WD repeat G protein beta family.
Contains 7 WD repeats. - Information by UniProt
-
Database links
- Entrez Gene: 59345 Human
- Entrez Gene: 14696 Mouse
- Entrez Gene: 294962 Rat
- Omim: 610863 Human
- SwissProt: Q9HAV0 Human
- SwissProt: P29387 Mouse
- SwissProt: Q3THF3 Mouse
- SwissProt: Q3TY18 Mouse
see all -
Alternative names
- G protein beta 4 subunit antibody
- GBB4_HUMAN antibody
- GNB 4 antibody
see all
Images
-
Western blot - Anti-GNB4 antibody (ab223113)All lanes : Anti-GNB4 antibody (ab223113) at 1/500 dilution
Lane 1 : Rat liver tissue lysate
Lane 2 : Mouse liver tissue lysate
Lane 3 : Mouse kidney tissue lysate
Secondary
All lanes : Goat Anti-Rabbit IgG at 1/50000 dilution
Predicted band size: 38 kDa
Observed band size: 38 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNB4 antibody (ab223113)Paraffin-embedded human pancreatic cancer tissue stained for GNB4 using ab223113 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNB4 antibody (ab223113)Paraffin-embedded human colon cancer tissue stained for GNB4 using ab223113 at 1/100 dilution in immunohistochemical analysis.
-
Immunocytochemistry/ Immunofluorescence - Anti-GNB4 antibody (ab223113)HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for GNB4 (green) using ab223113 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).
Protocols
References
ab223113 has not yet been referenced specifically in any publications.
