Overview

  • Product name

  • Description

    Rabbit polyclonal to GNG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Fusion protein corresponding to Human GNG2 aa 1-71. The identity of the protein fusion partner is GST.
    Sequence:

    MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPL LTPVPASENPFREKKFFCAIL


    Database link: P59768

  • Positive control

    • Mouse paranephros tissue lysate; Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab198225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 8 kDa.
IHC-P 1/50 - 1/200.

Target

Images

  • Anti-GNG2 antibody (ab198225) at 1/300 dilution + Mouse paranephros tissue lysate at 40 µg

    Developed using the ECL technique.

    Predicted band size: 8 kDa


    Exposure time: 5 minutes


    Gel: 10% SDS-PAGE

  • Immunohistochemical analysis of paraffin-embedded Human brain tissue labeling GNG2 with ab198225 at 1/60 dilution.

References

ab198225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up