Overview

  • Product name

  • Description

    Rabbit polyclonal to GNG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human GNG2 aa 7-64.
    Sequence:

    ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPA SENPFREK


    Database link: P59768

  • Positive control

    • IHC-P: Human colon tissue. ICC//IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for GNG2 (green) using ab224058 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human colon tissue stained for GNG2 with ab224058 (1/50 dilution) in immunohistochemical analysis.

References

ab224058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up