Anti-GNG4 antibody (ab238868)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GNG4 antibody -
Description
Rabbit polyclonal to GNG4 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human GNG4 aa 1-72. Full length mature chain without propeptide.
Sequence:MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVR EDPLIIPVPASENPFREKKFFC
Database link: P50150 -
Positive control
- IHC-P: Human pancreas and kidney tissue. ICC/IF: HepG2 cells.
-
General notes
This product was previously labelled as G gamma4
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.03% Proclin
Constituents: 50% Glycerol, PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238868 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | 1/50 - 1/200. | |
| IHC-P | 1/20 - 1/200. |
Target
-
Relevance
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. G gamma4 interacts with beta-1 and beta-2, but not with beta-3. It is expressed in brain, kidney, pancreas, skeletal muscle and faintly in cardiac muscle. -
Database links
- Entrez Gene: 2786 Human
- Entrez Gene: 14706 Mouse
- Omim: 604388 Human
- SwissProt: P50150 Human
- SwissProt: P50153 Mouse
-
Alternative names
- GNG4 antibody
- GNGT4 antibody
- Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-4 subunit antibody
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-GNG4 antibody (ab238868)HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for GNG4 (green) using ab238868 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNG4 antibody (ab238868)Paraffin-embedded human pancreas tissue stained for GNG4 using ab238868 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNG4 antibody (ab238868)Paraffin-embedded human kidney tissue stained for GNG4 using ab238868 at 1/100 dilution in immunohistochemical analysis.
References
ab238868 has not yet been referenced specifically in any publications.
