Anti-GNG4 antibody (ab238868)
Key features and details
- Rabbit polyclonal to GNG4
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GNG4 antibody -
Description
Rabbit polyclonal to GNG4 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Orangutan -
Immunogen
Recombinant full length protein corresponding to Human GNG4 aa 1-72. Full length mature chain without propeptide.
Sequence:MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVR EDPLIIPVPASENPFREKKFFC
Database link: P50150 -
Positive control
- IHC-P: Human pancreas and kidney tissue. ICC/IF: HepG2 cells.
-
General notes
This product was previously labelled as G gamma4
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab238868 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | 1/50 - 1/200. | |
IHC-P | 1/20 - 1/200. |
Target
-
Relevance
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. G gamma4 interacts with beta-1 and beta-2, but not with beta-3. It is expressed in brain, kidney, pancreas, skeletal muscle and faintly in cardiac muscle. -
Database links
- Entrez Gene: 2786 Human
- Entrez Gene: 14706 Mouse
- Omim: 604388 Human
- SwissProt: P50150 Human
- SwissProt: P50153 Mouse
-
Alternative names
- GNG4 antibody
- GNGT4 antibody
- Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-4 subunit antibody
Images
-
HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for GNG4 (green) using ab238868 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNG4 antibody (ab238868)
Paraffin-embedded human pancreas tissue stained for GNG4 using ab238868 at 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNG4 antibody (ab238868)
Paraffin-embedded human kidney tissue stained for GNG4 using ab238868 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab238868 has not yet been referenced specifically in any publications.