Overview

  • Product name

  • Description

    Rabbit polyclonal to GNG5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human GNG5 aa 2-65. Full length mature chain without propeptide.
    Sequence:

    SGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTG VSSSTNPFRPQKVC


    Database link: P63218

  • Positive control

    • IHC-P: Human liver cancer and kidney tissues. ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238835 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

Images

  • PC-3 (Human prostate adenocarcinoma cell line) cells stained for GNG5 (green) using ab238835 at 1/100 dilution in ICC/IF, followed by an Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human liver cancer tissue stained for GNG5 using ab238835 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for GNG5 using ab238835 at 1/100 dilution in immunohistochemical analysis.

References

ab238835 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238835.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up