Overview

  • Product name

  • Description

    Rabbit polyclonal to GNL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human GNL1 aa 251-500.
    Sequence:

    VVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVG KVDLSSWREKIARDVAGATWGNGSGEEEEEEDGPAVLVEQQTDSAMEPTG PTQERYKDGVVTIGCVGFPNVGKSSLINGLVGRKVVSVSRTPGHTRYFQT YFLTPSVKLCDCPGLIFPSLLPRQLQVLAGIYPIAQIQEPYTAVGYLASR IPVQALLHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYR


    Database link: P36915

  • Positive control

    • WB: A431 and Jurkat whole cell lysate. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236622 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Possible regulatory or functional link with the histocompatibility cluster.
  • Sequence similarities

    Belongs to the MMR1/HSR1 GTP-binding protein family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • Domain

    In contrast to other GTP-binding proteins, this family is characterized by a circular permutation of the GTPase motifs described by a G4-G1-G3 pattern.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt
  • Database links

  • Alternative names

    • Gnl1 antibody
    • GNL1_HUMAN antibody
    • GTP binding protein HSR1 antibody
    • GTP-binding protein HSR1 antibody
    • Guanine nucleotide binding protein like 1 antibody
    • Guanine nucleotide-binding protein-like 1 antibody
    • HSR1 antibody
    • HSR1 GTP binding protein antibody
    see all

Images

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for GNL1 (Green) using ab236622 at a 1/100 dilution in ICC/IF. Secondary used is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Anti-GNL1 antibody (ab236622) at 1/500 dilution + Jurkat (Human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Anti-GNL1 antibody (ab236622) at 1/500 dilution + A431 (Human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

References

ab236622 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236622.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up