Overview

  • Product name

  • Description

    Rabbit polyclonal to GNMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human GNMT aa 70-105 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    VDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHE


    Database link: Q14749

  • Positive control

    • Rat kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 33 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

  • Function

    Catalyzes the methylation of glycine by using S-adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy). Possible crucial role in the regulation of tissue concentration of AdoMet and of metabolism of methionine.
  • Tissue specificity

    Abundant in liver.
  • Involvement in disease

    Defects in GNMT are the cause of glycine N-methyltransferase deficiency (GNMT deficiency) [MIM:606664]; also known as hypermethioninemia. The only clinical abnormalities in patients with this deficiency are mild hepatomegaly and chronic elevation of serum transaminases.
  • Sequence similarities

    Belongs to the glycine N-methyltransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.1.1.20 antibody
    • Epididymis secretory sperm binding protein Li 182mP antibody
    • Glycine N methyltransferase antibody
    • Glycine N-methyltransferase antibody
    • Gnmt antibody
    • GNMT_HUMAN antibody
    • HEL S 182mP antibody
    • OTTHUMP00000016412 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat kidney tissue labeling GNMT with ab203396 at 1/200 followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Walters RO  et al. Sarcosine Is Uniquely Modulated by Aging and Dietary Restriction in Rodents and Humans. Cell Rep 25:663-676.e6 (2018). Read more (PubMed: 30332646) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up