Overview

  • Product name

  • Description

    Rabbit polyclonal to GNMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Pig
  • Immunogen

    Recombinant fragment corresponding to Human GNMT aa 114-180.
    Sequence:

    EEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNI ASMVRAGGLLVIDHRNY


    Database link: Q14749

  • Positive control

    • IHC-P: Human pancreas tissue. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Catalyzes the methylation of glycine by using S-adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy). Possible crucial role in the regulation of tissue concentration of AdoMet and of metabolism of methionine.
  • Tissue specificity

    Abundant in liver.
  • Involvement in disease

    Defects in GNMT are the cause of glycine N-methyltransferase deficiency (GNMT deficiency) [MIM:606664]; also known as hypermethioninemia. The only clinical abnormalities in patients with this deficiency are mild hepatomegaly and chronic elevation of serum transaminases.
  • Sequence similarities

    Belongs to the glycine N-methyltransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.1.1.20 antibody
    • Epididymis secretory sperm binding protein Li 182mP antibody
    • Glycine N methyltransferase antibody
    • Glycine N-methyltransferase antibody
    • Gnmt antibody
    • GNMT_HUMAN antibody
    • HEL S 182mP antibody
    • OTTHUMP00000016412 antibody
    see all

Images

  • Paraffin-embedded human pancreas tissue stained for GNMT using ab224753 at 1/1000 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for GNMT (green) using ab224753 at 4 µg/ml in ICC/IF.

References

ab224753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up