Overview

  • Product name

  • Description

    Rabbit polyclonal to GNPNAT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human GNPNAT1 aa 1-184.
    Sequence:

    MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLN RGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVAT ATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNC YKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK


    Database link: Q96EK6

  • Positive control

    • WB: MCF7 whole cell lysate. Mouse liver, kidney and stomach tissue lysates. IHC-P: Human gastric cancer and lung cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab234981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 21 kDa.
IHC-P 1/20 - 1/200.

Target

  • Pathway

    Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D-glucosamine biosynthesis; N-acetyl-alpha-D-glucosamine 1-phosphate from alpha-D-glucosamine 6-phosphate (route I): step 1/2.
  • Sequence similarities

    Belongs to the acetyltransferase family. GNA1 subfamily.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization

    Golgi apparatus membrane. Endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AU017428 antibody
    • AU040593 antibody
    • EMeg32 antibody
    • FLJ10607 antibody
    • Glucosamine 6 phosphate acetyltransferase antibody
    • Glucosamine 6 phosphate N acetyltransferase antibody
    • Glucosamine 6-phosphate N-acetyltransferase antibody
    • Glucosamine phosphate N acetyltransferase 1 antibody
    • GNA1 antibody
    • GNA1_HUMAN antibody
    • GNPNAT antibody
    • GNPNAT1 antibody
    • Gpnat1 antibody
    • Gsnpat antibody
    • Phosphoglucosamine acetylase antibody
    • Phosphoglucosamine transacetylase antibody
    • RGD1563144 antibody
    see all

Images

  • All lanes : Anti-GNPNAT1 antibody (ab234981) at 1/500 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : Mouse stomach tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 21 kDa

  • Paraffin-embedded human gastric cancer tissue stained for GNPNAT1 with ab234981 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for GNPNAT1 with ab234981 at 1/100 dilution in immunohistochemical analysis.

References

ab234981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up