Overview

  • Product name

    Anti-GNRH2 antibody
  • Description

    Rabbit polyclonal to GNRH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human GNRH2 aa 24-120. Mature full length chain without signal peptide.
    Sequence:

    QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLPSDA LAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV


    Database link: O43555-1

  • Positive control

    • IHC-P: Human ovarian cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
  • Tissue specificity

    Midbrain; expressed at significantly higher levels outside the brain (up to 30-fold), particularly in the kidney, bone marrow and prostate.
  • Sequence similarities

    Belongs to the GnRH family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • GnRH II antibody
    • GnRH-associated peptide 2 antibody
    • GnRH-associated peptide II antibody
    • gnrh2 antibody
    • GON2_HUMAN antibody
    • Gonadoliberin II antibody
    • Gonadotropin-releasing hormone 2 antibody
    • Gonadotropin-releasing hormone II antibody
    • LH-RH II antibody
    • Luliberin II antibody
    • Luteinizing hormone-releasing hormone II antibody
    • Progonadoliberin 2 antibody
    • Progonadoliberin II antibody
    see all

Images

  • Paraffin-embedded human ovarain cancer tissue stained for GNRH2 using ab238844 at 1/100 dilution in immunohistochemical analysis.

References

ab238844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up