Overview

  • Product name

  • Description

    Rabbit polyclonal to GnRHR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Goat, Human
  • Immunogen

    Synthetic peptide within Human GnRHR aa 233-281 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    KIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWT


    Database link: P30968

  • Positive control

    • Human breast cancer and Rat brain tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab202848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/100 - 1/1000. Predicted molecular weight: 38 kDa.

Target

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human breast cancer tissue labeling GnRHR with ab202848 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat brain tissue labeling GnRHR with ab202848 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Rat brain tissue labeling GnRHR with ab202848 at 1/200 dilution, followed by Goat Anti-Rabbit IgG, Cy3 conjugated secondary antibody at 1/200 dilution.

References

This product has been referenced in:

  • Gao X  et al. Prenatal exposure to zearalenone disrupts reproductive potential and development via hormone-related genes in male rats. Food Chem Toxicol 116:11-19 (2018). WB . Read more (PubMed: 29627501) »
See 1 Publication for this product

Customer reviews and Q&As

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Sheep Tissue sections (Pituitary)
Antigen retrieval step
Heat mediated
Specification
Pituitary
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5 · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 03 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up