Anti-GNRPX antibody (ab230529)
Key features and details
- Rabbit polyclonal to GNRPX
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GNRPX antibody
See all GNRPX primary antibodies -
Description
Rabbit polyclonal to GNRPX -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human GNRPX aa 1-147.
Sequence:MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRT DEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWM EALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA
Database link: Q9NW61 -
Positive control
- WB: Human fetal liver lysate. IHC-P: Human kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituent: PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab230529 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 µg/ml. | |
WB | 1/1000 - 1/2000. Predicted molecular weight: 18 kDa. |
Target
-
Tissue specificity
Expressed in testis and liver. -
Sequence similarities
Contains 1 PH domain. - Information by UniProt
-
Database links
- Entrez Gene: 55111 Human
- SwissProt: Q9NW61 Human
- Unigene: 501353 Human
-
Alternative names
- 9530063M10Rik antibody
- FLJ10297 antibody
- Guanine nucleotide releasing protein x antibody
see all
Images
-
Anti-GNRPX antibody (ab230529) at 1/1000 dilution + Human fetal liver lysate
Developed using the ECL technique.
Predicted band size: 18 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GNRPX antibody (ab230529)
Formalin-fixed, paraffin-embedded human kidney tissue stained for GNRPX with ab230529 at 5 μg/ml in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab230529 has not yet been referenced specifically in any publications.