Overview

  • Product name

    Anti-GOLGA5/Golgin-84 antibody
    See all GOLGA5/Golgin-84 primary antibodies
  • Description

    Rabbit polyclonal to GOLGA5/Golgin-84
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human GOLGA5/Golgin-84 aa 159-306.
    Sequence:

    SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAAC PDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEE LNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV


    Database link: Q8TBA6

  • Positive control

    • IHC: Mouse globus pallidus, motor cortex, thalamus, hippocampus and mescencephalic reticular formation tissue; human cerebral cortex, hippocampus, kidney, testis and stomach tissue. WB: U-87 MG cell lysate. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as GOLGA5

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB 1/100 - 1/250. Predicted molecular weight: 83 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Involved in maintaining Golgi structure. Stimulates the formation of Golgi stacks and ribbons. Involved in intra-Golgi retrograde transport.
  • Tissue specificity

    Ubiquitous. Highly expressed in seminiferous tubules and Leydig cells in testis, and detected at much lower levels in the other tissues tested. Expression is very low or not detectable in spermatozoa.
  • Involvement in disease

    Defects in GOLGA5 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving GOLGA5 is found in thyroid papillary carcinomas. Translocation t(10;14)(q11;q32) with RET. The translocation generates the RET/GOLGA5 (PTC5) oncogene which was found in 2 cases of PACT in children exposed to radioactive fallout after Chernobyl.
  • Post-translational
    modifications

    Highly phosphorylated during mitosis. Phosphorylation is barely detectable during interphase.
  • Cellular localization

    Golgi apparatus membrane. Found throughout the Golgi, both on cisternae and, at higher abundance, on the tubulo-vesicular structures of the cis-Golgi network.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cell proliferation inducing gene 31 antibody
    • Cell proliferation-inducing gene 31 protein antibody
    • GOGA5_HUMAN antibody
    • GOLGA 5 antibody
    • GOLGA5 antibody
    • Golgi autoantigen golgin subfamily a 5 antibody
    • Golgi integral membrane protein 5 antibody
    • Golgin 84 antibody
    • Golgin A5 antibody
    • Golgin subfamily A member 5 antibody
    • Golgin-84 antibody
    • Golgin84 antibody
    • GOLIM 5 antibody
    • GOLIM5 antibody
    • Protein Ret-II antibody
    • PTC5 antibody
    • Ret fused gene 5 antibody
    • RET fused gene 5 protein antibody
    • Ret II antibody
    • Ret II protein antibody
    • RET-fused gene 5 protein antibody
    • RFG 5 antibody
    • RFG5 antibody
    see all

Images

  • Anti-GOLGA5/Golgin-84 antibody (ab224040) at 1/100 dilution + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) cell lysate

    Predicted band size: 83 kDa

  • Immunohistochemical analysis oh human kidney tissue staining GOLGA5 with ab224040 at 1/200 dilution.

  • Immunohistochemical analysis oh human testis tissue staining GOLGA5 with ab224040 at 1/200 dilution.

  • Paraffin-embedded mouse globus pallidus tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse motor cortex tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse thalamus tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse hippocampus tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded mouse mesencephalic tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human hippocampus tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human stomach tissue stained for GOLGA5/Golgin-84 using ab224040 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for GOLGA5/Golgin-84 (green) using ab224040 at 4 µg/ml in ICC/IF.

References

ab224040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up