Overview

  • Product name

    Anti-GOLPH2 antibody [OTI6C9]
    See all GOLPH2 primary antibodies
  • Description

    Mouse monoclonal [OTI6C9] to GOLPH2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Human, Monkey
  • Immunogen

    Recombinant full length protein corresponding to Human GOLPH2 aa 1-401. Produced in HEK-293T cells (NP_808800).
    Sequence:

    MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELE GRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQ DEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLER KFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQL QALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQV EKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTP QVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHT L


    Database link: Q8NBJ4

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV-ENTRY GOLPH2 cDNA; HeLa, A549 and COS-7 cell extracts. IHC-P: Human ovary adenocarcinoma, thyroid carcinoma, endometrium, endometrium adenocarcinoma, prostate and bladder carcinoma tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY GOLPH2.
  • General notes

    The clone number has been updated from 6C9 to OTI6C9, both clone numbers name the same clone.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant by affinity chromatography.
  • Clonality

    Monoclonal
  • Clone number

    OTI6C9
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab119800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 45 kDa.
IHC-P 1/150.
ICC/IF 1/100.
Flow Cyt Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function

    Unknown. Cellular response protein to viral infection.
  • Tissue specificity

    Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), it is strongly expressed in hepatocyte-derived syncitial giant cells. Constitutively expressed by biliary epithelial cells but not by hepatocytes.
  • Sequence similarities

    Belongs to the GOLM1/CASC4 family.
  • Post-translational
    modifications

    Glycosylated.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Golgi apparatus > cis-Golgi network membrane. Early Golgi. Cycles via the cell surface and endosomes upon lumenal pH disruption.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA379P1.3 antibody
    • C9orf155 antibody
    • Chromosome 9 open reading frame 155 antibody
    • Golgi membrane protein 1 antibody
    • Golgi membrane protein GP73 antibody
    • Golgi phosphoprotein 2 antibody
    • Golgi protein 73 kD antibody
    • Golgi protein 73kD antibody
    • GOLM 1 antibody
    • GOLM1 antibody
    • GOLM1_HUMAN antibody
    • GOLPH 2 antibody
    • GOLPH2 antibody
    • GP 73 antibody
    • GP73 antibody
    • PSEC0257 antibody
    see all

Images

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for GOLPH2 using ab119800 at 1/150 dilution in immunohistochemical analysis.

  • Overlay histogram showing HeLa cells stained with ab119800 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab119800, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was Alexa Fluor® 488 goat anti-mouse IgG (H&L) (ab150113) at 1/2000 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 1μg/1x106 cells) used under the same conditions. Unlabelled sample (blue line) was also used as a control. Acquisition of >5,000 events were collected using a 20mW Argon ion laser (488nm) and 525/30 bandpass filter.
  • All lanes : Anti-GOLPH2 antibody [OTI6C9] (ab119800) at 1/500 dilution

    Lane 1 : HEK293T cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK293T cell lysate transfected with pCMV6-ENTRY GOLPH2

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 45 kDa

  • All lanes : Anti-GOLPH2 antibody [OTI6C9] (ab119800) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 45 kDa



    HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC200086)
  • Paraffin-embedded human thyroid carcinoma tissue stained for GOLPH2 using ab119800 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium tissue stained for GOLPH2 using ab119800 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for GOLPH2 using ab119800 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for GOLPH2 using ab119800 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder carcinoma tissue stained for GOLPH2 using ab119800 at 1/150 dilution in immunohistochemical analysis.

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY GOLPH2 stained for GOLPH2 (green) using ab119800 at 1/100 dilution in ICC/IF.

References

ab119800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab119800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up