Overview

  • Product name

  • Description

    Rabbit polyclonal to GPA33
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat GPA33 aa 22-235. Expressed in E.coli.
    Sequence:

    ITVETTQDVLRAARGKSVTLPCIYSTPVSDRQGFIQWDKLLRSQTEKVAT WTFETKKYTYGSRYENRVRISNDAELSNASITIDQLTMDDNGTYECSVSL MSDQDVTSRSRVRLLVLVPPSKPDCGIEGETVIGNNIQLTCHSAEGSPSP QYSWKSYNAQNQQRPLAQPVSGEPLLLKNISADTAGYYICTSSNDVGTE FCNITVAPRPPSMNI


    Database link: D3ZRJ6

  • Positive control

    • WB: Recombinant rat GPA33 protein; rat large intestine lysate; mouse small intestine lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 36 kDa.

Target

  • Function

    May play a role in cell-cell recognition and signaling.
  • Tissue specificity

    Expressed in normal gastrointestinal epithelium and in 95% of colon cancers.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated, contains approximately 8 kDa of N-linked carbohydrate.
    Palmitoylated.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A33 antibody
    • Cell surface A33 antigen antibody
    • Cell surface A33 antigen precursor antibody
    • Glycoprotein A33 (transmembrane) antibody
    • Glycoprotein A33 antibody
    • Gpa33 antibody
    • GPA33_HUMAN antibody
    • MGC129986 antibody
    • MGC129987 antibody
    • OTTHUMP00000032346 antibody
    • Transmembrane glycoprotein A33 antibody
    see all

Images

  • All lanes : Anti-GPA33 antibody (ab231592) at 1 µg/ml

    Lane 1 : Rat large intestine tissue lysate
    Lane 2 : Mouse small intestine tissue lysate

    Secondary
    All lanes : HRP-linked guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 36 kDa

  • Anti-GPA33 antibody (ab231592) at 1 µg/ml + Recombinant rat GPA33 protein

    Predicted band size: 36 kDa

References

ab231592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up