Anti-GPATCH3 antibody (ab220701)
Key features and details
- Rabbit polyclonal to GPATCH3
- Suitable for: ICC/IF
- Reacts with: Human
Overview
-
Product name
Anti-GPATCH3 antibody
See all GPATCH3 primary antibodies -
Description
Rabbit polyclonal to GPATCH3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human GPATCH3 aa 408-492.
Sequence:RHTKGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHG EKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQTES
Database link: Q96I76 -
Positive control
- U251 MG cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab220701 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Sequence similarities
Contains 1 G-patch domain. - Information by UniProt
-
Database links
- Entrez Gene: 63906 Human
- Entrez Gene: 242691 Mouse
- Entrez Gene: 362615 Rat
- SwissProt: Q96I76 Human
- SwissProt: Q8BIY1 Mouse
- Unigene: 10903 Human
- Unigene: 40110 Mouse
-
Alternative names
- DKFZp686E0221 antibody
- FLJ12455 antibody
- G patch domain containing 3 antibody
see all
Images
-
Immunodiffusion - Anti-GPATCH3 antibody (ab220701)
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U251 MG cells labeling GPATCH3 with ab220701 at 4 µg/ml (green).
Protocols
Datasheets and documents
References (0)
ab220701 has not yet been referenced specifically in any publications.
