Anti-GPCR GPR103 antibody - N-terminal (ab224372)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GPCR GPR103 antibody - N-terminal
See all GPCR GPR103 primary antibodies -
Description
Rabbit polyclonal to GPCR GPR103 - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human GPCR GPR103 aa 1-47 (N terminal).
Sequence:MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA
Database link: Q96P65 -
Positive control
- IHC-P: Human urinary bladder tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab224372 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Receptor for the orexigenic neuropeptide QRFP. The activity of this receptor is mediated by G proteins that modulate adenylate cyclase activity and intracellular calcium levels. -
Tissue specificity
Expressed widely in the brain with high levels in the hypothalamus, trigeminal ganglia and vestibular neurons, and moderate levels in the amygdala, cortex, pituitary, hippocampus, thalamus, caudate nucleus and medulla oblongata. In peripheral tissues, expressed at high levels in the retina and at moderate levels in the heart, kidney, testis and thyroid. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 84109 Human
- Omim: 606925 Human
- SwissProt: Q96P65 Human
- Unigene: 368977 Human
-
Alternative names
- AQ27 antibody
- G protein-coupled receptor 103 antibody
- G-protein coupled receptor 103 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPCR GPR103 antibody - N-terminal (ab224372)Paraffin-embedded human urinary bladder tissue stained for GPCR GPR103 using ab224372 at 1/20 dilution in immunohistochemical analysis.
Datasheets and documents
References
ab224372 has not yet been referenced specifically in any publications.
