Overview

  • Product name

  • Description

    Rabbit polyclonal to GPCR GPR126
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human GPCR GPR126 aa 765-810 (internal sequence) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LVSYVMACSIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDLNK


    Database link: Q86SQ4

  • Positive control

    • Human placenta and mouse liver tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab218046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/600. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Orphan receptor. May be required for normal differentiation of promyelinating Schwann cells and for normal myelination of axons. Signals probably through G-proteins to transiently elevate cAMP levels.
  • Tissue specificity

    Expressed in placenta and to a lower extent in pancreas and liver. Detected in aortic endothelial cells but not in skin microvascular endothelial cells.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily.
    Contains 1 CUB domain.
    Contains 1 GPS domain.
    Contains 1 pentaxin domain.
  • Post-translational
    modifications

    Proteolytically cleaved into 2 conserved sites: one in the GPS domain (S1 site) and the other in the middle of the extracellular domain (S2 site). The proteolytic cleavage at S1 site generates an extracellular subunit and a seven-transmembrane subunit. Furin is involved in the cleavage of the S2 site generating a soluble fragment. Processing at the GPS domain occurred independent of and probably prior to the cleavage at the S2 site.
  • Cellular localization

    Cell membrane. Detected on the cell surface of activated but not resting umbilical vein.
  • Information by UniProt
  • Database links

  • Alternative names

    • adhesion G protein coupled receptor G6 antibody
    • APG1 antibody
    • Developmentally regulated G protein coupled receptor antibody
    • Developmentally regulated G-protein-coupled receptor antibody
    • dj287g14.2 antibody
    • DREG antibody
    • G protein coupled receptor 126 antibody
    • G-protein coupled receptor 126 antibody
    • GP126_HUMAN antibody
    • GPR126 antibody
    • HBV PreS1 transactivated protein 2 antibody
    • HBV PreS1-transactivated protein 2 antibody
    • LCCS9 antibody
    • OTTHUMP00000017320 antibody
    • OTTHUMP00000237093 antibody
    • OTTHUMP00000237094 antibody
    • OTTHUMP00000237115 antibody
    • PR126 antibody
    • Probable G protein coupled receptor 126 [Precursor] antibody
    • Probable G protein coupled receptor 126 antibody
    • Probable G-protein coupled receptor 126 [Precursor] antibody
    • Probable G-protein coupled receptor 126 antibody
    • PS1TP2 antibody
    • Vascular inducible G protein coupled receptor antibody
    • Vascular inducible G protein-coupled receptor antibody
    • VIGR antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Human placenta tissue labeling GPCR GPR126 with ab218046 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded mouse liver tissue labeling GPCR GPR126 with ab218046 at 1/600 dilution, followed by conjugation to the secondary antibody and DAB staining.

    After antigen retrieval, endogenous peroxidase was blocked by 3% hydrogen peroxide for 30 minutes. Blocking buffer (normal goat serum) at 37°C for 20 minutes. Antibody incubation with ab218046 was done overnight at 4°C.

References

ab218046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
ELISA
Sample
African green monkey Cell (COS-7)
Specification
COS-7
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 37°C
Type
Indirect

Abcam user community

Verified customer

Submitted Feb 27 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up