Anti-GPCR GPR34 antibody (ab224358)
Key features and details
- Rabbit polyclonal to GPCR GPR34
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GPCR GPR34 antibody
See all GPCR GPR34 primary antibodies -
Description
Rabbit polyclonal to GPCR GPR34 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Gorilla -
Immunogen
Recombinant fragment corresponding to Human GPCR GPR34 aa 2-50.
Sequence:RSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDE
Database link: Q9UPC5 -
Positive control
- IHC-P: Human cerebral cortex.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224358 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. GPCR GPR34 is a member of this family (subfamily Orphan-A). It has been reported to be expressed in the brain, particularly in caudate, frontal cortex, putamen, and thalamus, as well as in eye, liver, and testis. ESTs have been isolated from adipose, B-cell/lung/testis, eye, liver/spleen, placenta, tonsil, and uterus libraries. -
Cellular localization
Cell membrane; Multi-pass membrane protein. -
Database links
- Entrez Gene: 473572 Chimpanzee
- Entrez Gene: 2857 Human
- Omim: 300241 Human
- SwissProt: P60019 Chimpanzee
- SwissProt: Q6XCF2 Gorilla
- SwissProt: Q9UPC5 Human
- Unigene: 495989 Human
-
Alternative names
- G protein coupled receptor 34 antibody
- GPCR 34 antibody
- GPCR34 antibody
see all
Images
Datasheets and documents
References (0)
ab224358 has not yet been referenced specifically in any publications.