Anti-GPCR GPR34 antibody (ab224358)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-GPCR GPR34 antibody
See all GPCR GPR34 primary antibodies -
Description
Rabbit polyclonal to GPCR GPR34 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Gorilla
-
Immunogen
Recombinant fragment corresponding to Human GPCR GPR34 aa 2-50.
Sequence:RSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDE
Database link: Q9UPC5 -
Positive control
- IHC-P: Human cerebral cortex.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab224358 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. GPCR GPR34 is a member of this family (subfamily Orphan-A). It has been reported to be expressed in the brain, particularly in caudate, frontal cortex, putamen, and thalamus, as well as in eye, liver, and testis. ESTs have been isolated from adipose, B-cell/lung/testis, eye, liver/spleen, placenta, tonsil, and uterus libraries. -
Cellular localization
Cell membrane; Multi-pass membrane protein. -
Database links
- Entrez Gene: 473572 Chimpanzee
- Entrez Gene: 2857 Human
- Omim: 300241 Human
- SwissProt: P60019 Chimpanzee
- SwissProt: Q6XCF2 Gorilla
- SwissProt: Q9UPC5 Human
- Unigene: 495989 Human
-
Alternative names
- G protein coupled receptor 34 antibody
- GPCR 34 antibody
- GPCR34 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPCR GPR34 antibody (ab224358)Paraffin-embedded human cerebral cortex stained for GPCR GPR34 using ab224358 at 1/50 in immunohistochemical analysis.
Protocols
Datasheets and documents
References
ab224358 has not yet been referenced specifically in any publications.
