Overview

  • Product name

  • Description

    Rabbit polyclonal to GPCR GPR37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human GPCR GPR37 aa 220-265 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    AQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM


    Database link: O15354

  • Positive control

    • Rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab218134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Orphan receptor. May have a unique functional role in the central nervous system.
  • Tissue specificity

    Expressed in brain and spinal cord, and at lower levels in testis, placenta and liver, but no detectable expression observed in any other tissue. When overexpressed in cells, tends to become insoluble and unfolded. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (PDJ).
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    Ubiquitinated by PARK2 in the presence of UBE2E1 and UBE2L3 in the endoplasmic reticulum. The unfolded form is specifically ubiquitinated by SYVN1, which promotes its proteasomal degradation and prevents neuronal cell death.
  • Cellular localization

    Cell membrane. Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • EDNRBL antibody
    • Endothelin B receptor like protein 1 antibody
    • Endothelin B receptor-like protein 1 antibody
    • Endothelin receptor type B like antibody
    • ETBR LP 1 antibody
    • ETBR-LP-1 antibody
    • ETBRLP1 antibody
    • G protein coupled receptor 37 antibody
    • G protein coupled receptor 37 endothelin receptor type B like antibody
    • Gpr37 antibody
    • GPR37_HUMAN antibody
    • hET(B)R LP antibody
    • hET(B)RLP antibody
    • PAELR antibody
    • Parkin associated endothelin receptor like receptor antibody
    • Parkin-associated endothelin receptor-like receptor antibody
    • Probable G protein coupled receptor 37 antibody
    • Probable G-protein coupled receptor 37 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling GPCR GPR37 with ab218134 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up