Overview

  • Product name
    Anti-GPCR GPR55 antibody - C-terminal
    See all GPCR GPR55 primary antibodies
  • Description
    Rabbit polyclonal to GPCR GPR55 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human GPCR GPR55 aa 245-319 (C terminal). The exact sequence is proprietary.
    Sequence:

    GFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKE FRMNIRAHRPSRVQLVLQDTTISRG


    Database link: Q9Y2T6

  • Positive control
    • Human prostate tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab174700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function
    May be involved in hyperalgesia associated with inflammatory and neuropathic pain (By similarity). Receptor for L-alpha-lysophosphatidylinositol (LPI). LPI induces Ca(2+) release from intracellular stores via the heterotrimeric G protein GNA13 and RHOA. Putative cannabinoid receptor. May play a role in bone physiology by regulating osteoclast number and function.
  • Tissue specificity
    Expressed in the caudate nucleus and putamen, but not detected in the hippocampus, thalamus, pons cerebellum, frontal cortex of the brain or in the liver. Expressed in osteoclasts and osteoblasts.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • G protein coupled receptor 55 antibody
    • G-protein coupled receptor 55 antibody
    • GPCR GPR55 antibody
    • GPR 55 antibody
    • Gpr55 antibody
    • GPR55_HUMAN antibody
    • LPIR1 antibody
    • Probable G protein coupled receptor 55 antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin-embedded Human prostate tissue, labeling GPCR GPR55 with ab174700 at 10 µg/ml.

References

ab174700 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
50 µg
Gel Running Conditions
Reduced Denaturing (12)
Sample
Human Cell lysate - whole cell (PC-3 cell)
Specification
PC-3 cell
Treatment
10.15 ´M PMF
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C

Abcam user community

Verified customer

Submitted May 02 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up