Anti-GPCR GPR55 antibody - C-terminal (ab174700)
Key features and details
- Rabbit polyclonal to GPCR GPR55 - C-terminal
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GPCR GPR55 antibody - C-terminal
See all GPCR GPR55 primary antibodies -
Description
Rabbit polyclonal to GPCR GPR55 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human GPCR GPR55 aa 245-319 (C terminal). The exact sequence is proprietary.
Sequence:GFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKE FRMNIRAHRPSRVQLVLQDTTISRG
Database link: Q9Y2T6 -
Positive control
- Human prostate tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab174700 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
Use a concentration of 10 µg/ml.
|
Notes |
---|
IHC-P
Use a concentration of 10 µg/ml. |
Target
-
Function
May be involved in hyperalgesia associated with inflammatory and neuropathic pain (By similarity). Receptor for L-alpha-lysophosphatidylinositol (LPI). LPI induces Ca(2+) release from intracellular stores via the heterotrimeric G protein GNA13 and RHOA. Putative cannabinoid receptor. May play a role in bone physiology by regulating osteoclast number and function. -
Tissue specificity
Expressed in the caudate nucleus and putamen, but not detected in the hippocampus, thalamus, pons cerebellum, frontal cortex of the brain or in the liver. Expressed in osteoclasts and osteoblasts. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9290 Human
- Omim: 604107 Human
- SwissProt: Q9Y2T6 Human
- Unigene: 114545 Human
-
Alternative names
- G protein coupled receptor 55 antibody
- G-protein coupled receptor 55 antibody
- GPCR GPR55 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab174700 has not yet been referenced specifically in any publications.