Anti-GPCR GPRC5D antibody [6D9] - BSA and Azide free (ab55044)
Key features and details
- Mouse monoclonal [6D9] to GPCR GPRC5D - BSA and Azide free
- Suitable for: WB
- Reacts with: Recombinant fragment
- Isotype: IgG2b
Overview
-
Product name
Anti-GPCR GPRC5D antibody [6D9] - BSA and Azide free
See all GPCR GPRC5D primary antibodies -
Description
Mouse monoclonal [6D9] to GPCR GPRC5D - BSA and Azide free -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Recombinant fragment -
Immunogen
Recombinant fragment corresponding to Human GPCR GPRC5D aa 261-346.
Sequence:ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVA LTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV
-
General notes
This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: PBS -
Carrier free
Yes -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
6D9 -
Isotype
IgG2b -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab55044 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use at an assay dependent concentration. Predicted molecular weight: 39 kDa.
This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein. |
Notes |
---|
WB
Use at an assay dependent concentration. Predicted molecular weight: 39 kDa. This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein. |
Target
-
Tissue specificity
Widely expressed in the peripheral system. Expression pattern is high in pancreas, medium in kidney, small intestine, spleen and testis, low in lung, colon, leukocyte, prostate and thymus and not detectable in brain, heart, liver, placenta, skeletal muscle and ovary. -
Sequence similarities
Belongs to the G-protein coupled receptor 3 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Alternative names
- G protein coupled receptor family C group 5 member D antibody
- G-protein coupled receptor family C group 5 member D antibody
- GPC5D_HUMAN antibody
- GPRC5D antibody
Images
-
Western blot against tagged recombinant protein immunogen using ab55044 GPCR GPRC5D antibody at 1ug/ml. Predicted band size of immunogen is 35 kDa.
This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.
This image was generated using the ascites version of the product.
Protocols
Datasheets and documents
-
Datasheet download
References (0)
ab55044 has not yet been referenced specifically in any publications.