Overview

  • Product name

  • Description

    Rabbit polyclonal to GPCR MRGX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human GPCR MRGX2 aa 286-330. Cytoplasmic domain.
    Sequence:

    RKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQGTPEMSRSSLV


    Database link: Q96LB1

  • Positive control

    • WB: HEK-293T and MCF7 whole cell lysate; Mouse liver tissue lysate. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca(2+) but had no effect on basal or forskolin-stimulated cAMP levels, suggesting that this receptor is G(q)-coupled.
  • Tissue specificity

    Has a limited expression profile, both peripheral and within the central nervous system, with highest levels in dorsal root ganglion.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • G protein coupled receptor MRGX 2 antibody
    • G protein coupled receptor MRGX2 antibody
    • Mas related G protein coupled receptor member X2 antibody
    • Mas related gene MRGX 2 antibody
    • Mas related gene MRGX2 antibody
    • MAS related GPR member X2 antibody
    • Mas-related G-protein coupled receptor member X antibody
    • Mas-related G-protein coupled receptor member X2 antibody
    • MRGPRX 2 antibody
    • MRGPRX2 antibody
    • MRGX 2 antibody
    • MRGX2 antibody
    • MRGX2_HUMAN antibody
    see all

Images

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for GPCR MRGX2 (Green) using ab237047 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • All lanes : Anti-GPCR MRGX2 antibody (ab237047) at 1/1000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : MCF7 (Human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

References

ab237047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up