Overview

  • Product name

  • Description

    Rabbit polyclonal to GPI-PLD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human GPI-PLD aa 307-352.
    Sequence:

    NLTTSLTESVDRNINYTERGVFFSVNSWTPDSMSFIYKALERNIRT


    Database link: P80108

  • Positive control

    • A549, mouse brain and H9C2 lysates
  • General notes

    Previously labelled as GPLD1. 

Properties

  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab192543 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192543 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 90,120 kDa.

Target

  • Function

    This protein hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans (GPI-anchor) thus releasing these proteins from the membrane.
  • Sequence similarities

    Belongs to the GPLD1 family.
    Contains 7 FG-GAP repeats.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glycoprotein phospholipase D antibody
    • Glycosyl-phosphatidylinositol-specific phospholipase D antibody
    • GPI-PLD antibody
    • GPI-specific phospholipase D antibody
    • GPIPLD antibody
    • GPIPLDM antibody
    • GPLD1 antibody
    • MGC22590 antibody
    • PHLD_HUMAN antibody
    • Phosphatidylinositol glycan specific phospholipase D antibody
    • Phosphatidylinositol-glycan-specific phospholipase D antibody
    • PI-G PLD antibody
    • PIGPLD antibody
    • PIGPLD1 antibody
    see all

Images

  • All lanes : Anti-GPI-PLD antibody (ab192543)

    Lane 1 : A549 whole cell lysate
    Lane 2 : Mouse brain tissue lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 90,120 kDa

References

ab192543 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192543.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up