Anti-Gpihbp1 antibody (ab224728)
Key features and details
- Rabbit polyclonal to Gpihbp1
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Gpihbp1 antibody
See all Gpihbp1 primary antibodies -
Description
Rabbit polyclonal to Gpihbp1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human Gpihbp1 aa 21-151.
Sequence:QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKS LPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKT VEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG
Database link: Q8IV16 -
Positive control
- WB: Rat liver tissue lysate; mouse heart, lung and kidney tissue lysate. IHC-P: Human skin tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab224728 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/5000. Detects a band of approximately 20 kDa (predicted molecular weight: 20 kDa). | |
IHC-P | 1/20 - 1/200. |
Target
-
Function
Plays a key role in the lipolytic processing of chylomicrons. -
Sequence similarities
Contains 1 UPAR/Ly6 domain. -
Cellular localization
Cell membrane. Localized at the cell surface. - Information by UniProt
-
Database links
- Entrez Gene: 338328 Human
- Entrez Gene: 68453 Mouse
- Entrez Gene: 300027 Rat
- SwissProt: Q8IV16 Human
- SwissProt: Q9D1N2 Mouse
- Unigene: 426410 Human
- Unigene: 46367 Mouse
-
Alternative names
- Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 antibody
- GPI anchored HDL binding protein 1 antibody
- GPI anchored High Density Lipid binding protein 1 antibody
see all
Images
-
All lanes : Anti-Gpihbp1 antibody (ab224728) at 1/500 dilution
Lane 1 : Rat liver tissue lysate
Lane 2 : Mouse heart tissue lysate
Lane 3 : Mouse lung tissue lysate
Lane 4 : Mouse kidney tissue lysate
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 20 kDa
Observed band size: 20 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Gpihbp1 antibody (ab224728)
Paraffin-embedded human skin tissue stained for Gpihbp1 with ab224728 at 1/20 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab224728 has not yet been referenced specifically in any publications.