Overview

  • Product name

  • Description

    Rabbit polyclonal to GPM6B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human GPM6B aa 1-50 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MKPAMETAAEENTEQSQERKGCFECCIKCLGGVPYASLVATILCFSGVAL


    Database link: Q13491

  • Positive control

    • Rat brain tissue; Mouse brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab214459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 29 kDa.
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Block endogenous peroxidase by 3% hydrogen peroxide for 30 minutes

Target

  • Function

    May be involved in neural development. Involved in regulation of osteoblast function and bone formation. Involved in matrix vesicle release by osteoblasts; this function seems to involve maintenance of the actin cytoskeleton. May be involved in cellular trafficking of SERT and thereby in regulation of serotonin uptake.
  • Tissue specificity

    Neurons and glia; cerebellar Bergmann glia, in glia within white matter tracts of the cerebellum and cerebrum, and in embryonic dorsal root ganglia.
  • Sequence similarities

    Belongs to the myelin proteolipid protein family.
  • Cellular localization

    Cell membrane. Colocalizes with SERT at the plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • glycoprotein M6B antibody
    • GPM6B antibody
    • GPM6B_HUMAN antibody
    • M6b antibody
    • Neuronal membrane glycoprotein M6-b antibody
    • Neuronal membrane glycoprotein M6b antibody
    • protolipid M6B antibody
    • rhombex 29 antibody
    see all

Images

  • Immunohistochemical analysis of paraformaldehyde-fixed, paraffin-embedded rat brain tissue labeling GPM6B with ab214459 at 1/500 dilution, followed by conjugation to the secondary antibody and DAB staining.

     

  • Anti-GPM6B antibody (ab214459) at 1/300 dilution + Mouse brain lysate

    Predicted band size: 29 kDa

References

ab214459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up