Overview

  • Product name
    Anti-GPNMB antibody [7C10E5]
    See all GPNMB primary antibodies
  • Description
    Mouse monoclonal [7C10E5] to GPNMB
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human GPNMB aa 31-260.
    Sequence:

    NERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQA VLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADP YVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTL GQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVY VVTDQIPVFVTMFQKNDRNSSDETFLKDLP


    Database link: Q14956

  • Positive control
    • GPNMB recombinant protein; GPNMB-hIgGFc transfected HEK293 cell lysate; PANC1 and PC-3 cell lysate; Breast cancer tissues; Esophagus cancer tissues.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    0.5% protein stabilizer
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    Purified from tissue culture supernatant.
  • Clonality
    Monoclonal
  • Clone number
    7C10E5
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 64 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Could be a melanogenic enzyme.
  • Tissue specificity
    Not restricted to the melanocytic lineage.
  • Sequence similarities
    Belongs to the PMEL/NMB family.
    Contains 1 PKD domain.
  • Developmental stage
    Expression in poorly metastatic melanoma cell lines; no expression in highly metastatic melanoma cell lines.
  • Cellular localization
    Membrane. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • Glycoprotein (transmembrane) nmb antibody
    • Glycoprotein nmb antibody
    • Glycoprotein nmb like protein antibody
    • Gpnmb antibody
    • GPNMB_HUMAN antibody
    • HGFIN antibody
    • NMB antibody
    • Osteoactivin antibody
    • Transmembrane glycoprotein antibody
    • Transmembrane glycoprotein HGFIN antibody
    • Transmembrane glycoprotein NMB antibody
    see all

Images

  • All lanes : Anti-GPNMB antibody [7C10E5] (ab175427) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : GPNMB (AA: 31-260)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 64 kDa

  • Anti-GPNMB antibody [7C10E5] (ab175427) at 1/500 dilution + GPNMB recombinant protein.

    Predicted band size: 64 kDa

  • All lanes : Anti-GPNMB antibody [7C10E5] (ab175427) at 1/500 dilution

    Lane 1 : PANC1 cell lysate.
    Lane 2 : PC-3 cell lysate

    Predicted band size: 64 kDa

  • Immunohistochemical analysis of paraffin-embedded esophagus cancer tissues labeling GPNMB wiith ab175427 at 1/200 diution, with DAB staining.

  • Immunohistochemical analysis of paraffin-embedded breast cancer tissues labeling GPNMB wiith ab175427 at 1/200 diution, with DAB staining.

References

ab175427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up