Overview

  • Product name

  • Description

    Rabbit polyclonal to GPR171
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide within Human GPR171 aa 141-190 (internal sequence). The exact sequence is proprietary. (NP_037440.3)
    Sequence:

    MVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLN


    Database link: O14626

  • Positive control

    • IHC-P: Human prostate tissue. ICC/IF: MCF7 cells. WB: K562 cell extract.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol

    PBS is without Mg2+, Ca2+
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ICC/IF 1/100 - 1/500.

Target

Images

  • All lanes : Anti-GPR171 antibody (ab189282) at 1/500 dilution

    Lane 1 : K562 cell extract with Without synthesized peptide.
    Lane 2 : K562 cell extract with With synthesized peptide.

    Predicted band size: 37 kDa

  • Immunohistochemistry of formalin-fixed, paraffin-embedded human prostate tissue labeling GPR171 with ab189282 at 5 µg/ml.

  • Immunofluorescent analysis of MCF7 cells labeling GPR171 with ab189282 at 1/100 dilution (left). Right panel is treated with the immunizing peptide.

References

ab189282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up