Anti-GPR176 antibody (ab236970)
Key features and details
- Rabbit polyclonal to GPR176
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-GPR176 antibody
See all GPR176 primary antibodies -
Description
Rabbit polyclonal to GPR176 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human GPR176 aa 321-515.
Sequence:LTVNKSVRKCLIGTLVQLHHRYSRRNVVSTGSGMAEASLEPSIRSGSQLL EMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFSTCLEGEQGPQFAP SAPPLSTVDSVSQVAPAAPVEPETFPDKYSLQFGFGPFELPPQWLSETRN SKKRLLPPLGNTPEELIQTKVPKVGRVERKMSRNNKVSIFPKVDS
Database link: Q14439 -
Positive control
- WB: A431 whole cell lysate. ICC/IF: A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab236970 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/1000 - 1/5000. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Orphan receptor. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 11245 Human
- Entrez Gene: 381413 Mouse
- Entrez Gene: 117257 Rat
- Omim: 612183 Human
- SwissProt: Q14439 Human
- SwissProt: Q80WT4 Mouse
- SwissProt: Q64017 Rat
- Unigene: 37196 Human
see all -
Alternative names
- agr9 antibody
- G protein coupled receptor 176 antibody
- Gm1012 antibody
see all
Images
-
Anti-GPR176 antibody (ab236970) at 1/1000 dilution + A431 (human epidermoid carcinoma cell line) cell lysate
Secondary
Goat polyclonal to rabbit IgG at 1/10000 dilution -
A431 (human epidermoid carcinoma cell line) cells stained for GPR176 (green) using ab236970 at 1/50 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab236970 has not yet been referenced specifically in any publications.